Western blot - Anti-NADPH oxidase 4 Picoband antibody

NOX4 Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C662632-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: NOX4 antibody LS-C662632 is an unconjugated rabbit polyclonal antibody to human NOX4. Validated for IHC and WB.
Application: IHC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Kidney oxidase-1 | KOX | RENOX | KOX-1 | NADPH oxidase 4 | NOX4 | Renal NAD(P)H-oxidase
UniProt Number: Q9NPH5
NCBI GenBank: NM_016931 | NP_058627.1
SwissProt: Q9NPH5

Target: Human NOX4
Antigen Species: Human
Epitope: Expressed by distal tubular cells in kidney cortex and in endothelial cells (at protein level). Widely expressed. Strongly expressed in kidney and to a lower extent in heart, adipocytes, hepatoma, endothelial cells, skeletal muscle, brain, several brain tumor cell lines and airway epithelial cells.
Gene Name: NOX4

Immunogen: A synthetic peptide corresponding to a sequence of human NADPH oxidase 4 (ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL).
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Preservative: Yes

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl