Western blot testing of 1) rat testis and 2) human HepG2 lysate with LRIG3 antibody at 0.5ug/ml. Observed molecular weight: ~123 kDa (precursor), 140-170 kDa (glycosylated).

LRIG3 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C781877-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: LRIG3 antibody LS-C781877 is an unconjugated rabbit polyclonal antibody to LRIG3 from human. It is reactive with human and rat. Validated for WB.
Application: WB
Reactivity: Hu, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Recommended Dilution: WB: 0.5 - 1 µg/ml
NCBI GenBank: NP_001129523.1

Target

Target: Human LRIG3
Antigen Species: Human

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: aa 428-465 (NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ) from the human protein for the LRIG3 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS