LGALS8 / Galectin 8 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C490333-100
Catalog Number: LS-C490333
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Galectin 8 antibody LS-C490333 is an unconjugated rabbit polyclonal antibody to Galectin 8 (LGALS8) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Galectin-8g | LGALS8 | Galectin-8 | Po66-CBP | PCTA-1 | Gal-8 | Galectin 8 | PCTA1
- Recommended Dilution: WB
- 0.1 - 0.5 µg/ml
- UniProt Number
- O00214
- NCBI GenBank
- NM_006499 | NP_006490.3
- SwissProt
- O00214
Target
- Target
- Human LGALS8 / Galectin 8
- Antigen Species
- Human
- Gene Name
- LGALS8
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Amino acids HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW of human Galectin 8 were used as the immunogen for the Galectin 8 antibody.
- Immunogen Type
- Peptide
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS