Galectin 8 antibody Western blot. All lanes: Anti Galectin 8 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Kidney Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: A431 Whole Cell Lysate at 40 ug. Predicted band size: 36 kD. Observed band size: 50 kD.
LGALS8 / Galectin 8 Antibody (aa286-317)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human, Rat |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C407871-100
Catalog Number: LS-C407871
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Galectin 8 antibody LS-C407871 is an unconjugated rabbit polyclonal antibody to Galectin 8 (LGALS8) (aa286-317) from human. It is reactive with human and rat. Validated for WB.
- Application
- WB
- Reactivity
- Hu, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Galectin-8g | LGALS8 | Galectin-8 | Po66-CBP | PCTA-1 | Gal-8 | Galectin 8 | PCTA1
- UniProt Number
- O00214
- NCBI GenBank
- NM_006499 | NP_006490.3
- SwissProt
- O00214
Target
- Target
- Human LGALS8 / Galectin 8
- Antigen Species
- Human
- Epitope
- Ubiquitous. Selective expression by prostate carcinomas versus normal prostate and benign prostatic hypertrophy.
- Gene Name
- LGALS8
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human Galectin 8 (286-317 aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl