Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Anti-KLF2 antibody IHC of mouse lymphoid tissue. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
KLF2 Antibody (N-Terminus)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Mouse |
| Format: | Liquid |
$470.00each
Catalog Number: LS-B5627-50
Catalog Number: LS-B5627
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- KLF2 antibody LS-B5627 is an unconjugated rabbit polyclonal antibody to mouse KLF2 (N-Terminus). Validated for IHC and WB. Cited in 2 publications.
- Application
- IHC, IHC-P, WB
- Reactivity
- Ms
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Krueppel-like factor 2 | Kruppel-like factor LKLF | Kruppel-like factor 2 (lung) | Lung krueppel-like factor | LKLF | KLF2
- Recommended Dilution: IHC-P
- 5 µg/ml
- Recommended Dilution: WB
- 0.2 - 1 µg/ml
- UniProt Number
- Q9Y5W3
- SwissProt
- Q9Y5W3
Target
- Target
- KLF2
- Antigen Species
- Mouse
- Specificity
- Mouse KLF2
- Epitope
- Mouse KLF2
- Gene Name
- KLF2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Synthetic peptide from N-Terminus of mouse Klf2 (Q60843, NP_032478) within the region MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSM. Percent identity by BLAST analysis: Mouse, Zebra finch, Chicken (100%); Marmoset, Rat, Opossum (92%); Human, Gibbon, Galago, Pig (85%); Xenopus (83%).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, 0.09% sodium azide, 2% sucrose
- Concentration
- 0.5 mg/mL
- Volume
- 50 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles.
- Recommended Storage Buffer
- PBS
Disturbed shear stress reduces Klf2 expression in arterial-venous fistulae in vivo. Yamamoto K, Protack CD, Kuwahara G, Tsuneki M, Hashimoto T, Hall MR, Assi R, Brownson KE, Foster TR, Bai H, Wang M, Madri JA, Dardik A. Physiological reports. 2015;3.
PubMed: 25780089 · PMC: PMC4393175
Reduced patency in left-sided arteriovenous grafts in a porcine model. Shirley Liu, Tun Wang, Juan Wang, Toshihiko Isaji, Shun Ono, Arash Fereydooni, Ryosuke Taniguchi, Yutaka Matsubara, Laura E Niklason, Alan Dardik. Journal of vascular surgery. 2020 July;72:305-317.e6.
PubMed: 31699515 · PMC: PMC7196525
