ING1 antibody Western blot. All lanes: Anti ING1 at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: A549 Whole Cell Lysate at 40 ug. Predicted band size: 47 kD. Observed band size: 47 kD.

ING1 Antibody (aa192-223)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C407856-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ING1 antibody LS-C407856 is an unconjugated rabbit polyclonal antibody to human ING1 (aa192-223). Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Growth inhibitor ING1 | Growth inhibitor p33ing1 | ING1 | Inhibitor of growth protein 1 | p33 | p33ING1 | p47ING1a | Tumor suppressor ING1 | p33ING1b | Growth inhibitory protein ING1 | Inhibitor of growth 1 | p24ING1c
UniProt Number: Q9UK53
NCBI GenBank: NM_005537 | NP_005528.4
SwissProt: Q9UK53

Target

Target: Human ING1
Antigen Species: Human
Epitope: Isoform 2 was expressed in all normal tissues and cells examined, as well as in all breast cancer and melanoma cell lines examined. Isoform 3 was expressed in testis, liver, and kidney, weakly expressed in colon and brain and not expressed in breast and cultured melanocytes. Isoform 4 was highly expressed in testis and weakly expressed in brain, but not expressed in breast, colon, kidney, melanocytes, breast cancer or melanoma cell lines. .
Gene Name: ING1

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ING1 (192-223 aa KELDECYERFSRETDGAQKRRMLHCVQRALIR), different from the related mouse sequence by seven amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl