Western blot testing of 1) human HeLa, 2) human placenta, 3) rat thymus and 4) mouse thymus lysate with IL-22 antibody at 0.5ug/ml. Observed molecular weight: 19~25 kDa depending on glycosylation level.

IL22 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782031-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: IL22 antibody LS-C782031 is an unconjugated rabbit polyclonal antibody to IL22 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Cytokine Zcyto18 | ILTIF | Interleukin 22 | IL-22 | IL-D110 | TIFIL-23 | Zcyto18 | IL-TIF | IL22 | Interleukin-22
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q9GZX6
NCBI GenBank: NM_020525 | NP_065386.1
SwissProt: Q9GZX6

Target

Target: Human IL22
Antigen Species: Human
Gene Name: IL22

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids DDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNA were used as the immunogen for the IL-22 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS