Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot - Anti-IL22 Picoband Antibody
IL22 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C662041-100
Catalog Number: LS-C662041
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- IL22 antibody LS-C662041 is an unconjugated rabbit polyclonal antibody to human IL22. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Cytokine Zcyto18 | ILTIF | Interleukin 22 | IL-22 | IL-D110 | TIFIL-23 | Zcyto18 | IL-TIF | IL22 | Interleukin-22
- UniProt Number
- Q9GZX6
- NCBI GenBank
- NM_020525 | NP_065386.1
- SwissProt
- Q9GZX6
Target
- Target
- Human IL22
- Antigen Species
- Human
- Gene Name
- IL22
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence of human IL22 (DDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNA).
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
