SLCO1A2 / OATP Antibody
Catalog Number: LS-C805442
2 sizes / from $288.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Immunofluorescence, Western Blot
Reactivity: Human
Format: Liquid
Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC-plus™ SLCO1A2 / OATP Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$470.00each
Catalog Number: LS-B15526-50
Catalog Number: LS-B15526
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- OATP antibody LS-B15526 is an unconjugated rabbit polyclonal antibody to OATP (SLCO1A2) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- OATP-1 | Oatp1 | OATP1A2 | OATP-A | OATPA | SLCO1A2 | OATP | SLC21A3
- Recommended Dilution: IHC-P
- 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P46721
- NCBI GenBank
- NM_021094 | NP_066580.1
- SwissProt
- P46721
Target
- Target
- SLCO1A2 / OATP
- Antigen Species
- Human
- Specificity
- Human SLCO1A2 / OATP
- Epitope
- Human SLCO1A2 / OATP
- Gene Name
- SLCO1A2
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 606-670 of human SLCO1A2 (NP_602307.1). AALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTVLKDDELKTKL
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Concentration
- 1.12 mg/mL
- Volume
- 50 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
