Anti-PTGER4 / EP4 antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.

IHC-plus™ PTGER4 / EP4 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunocytochemistry, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Liquid

$383.00each

Catalog Number: LS-B6947-1

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: EP4 antibody LS-B6947 is an unconjugated rabbit polyclonal antibody to human EP4 (PTGER4). Validated for ICC, IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: ICC, IHC, IHC-P, WB
Reactivity: Hu
Predicted Reactivity: Bovine, Non-Human Primate, Rabbit
Intended Use: Research Use Only
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: EP4 | EP4 prostaglandin receptor | EP4R | PGE receptor EP4 subtype | Prostanoid EP4 receptor | Prostaglandin E receptor 4 | PTGER4 | PGE receptor, EP4 subtype | PGE2 receptor EP4 subtype
Recommended Dilution: IHC-P: 1:100
Recommended Dilution: WB: 1:200
UniProt Number: P35408
NCBI GenBank: NM_000958 | NP_000949.1
SwissProt: P35408

Target

Target: PTGER4 / EP4
Antigen Species: Human
Specificity: Does not cross-react with EP1, EP3, or EP4 receptors. The EP2 receptor appears to be expressed at low levels in many tissues and cell types, potentially making detection by immunochemical techniques difficult.
Epitope: Does not cross-react with EP1, EP3, or EP4 receptors. The EP2 receptor appears to be expressed at low levels in many tissues and cell types, potentially making detection by immunochemical techniques difficult.
Gene Name: PTGER4

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Origin Species: Human

Immunogen

Immunogen: Human EP4 receptor C-Terminus amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%); Gibbon, Bovine (97%); Rabbit (93%); Marmoset (90%); Bat, Hamster, Elephant, Panda (87%); Horse (83%); Mouse, Rat (80%).