Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)

IHC-plus™ Polyclonal Rabbit anti-Human SIRT3 / Sirtuin 3 Antibody (IHC, WB)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$383.00each

Catalog Number: LS-B13905-50

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: Sirtuin 3 antibody LS-B13905 is an unconjugated rabbit polyclonal antibody to Sirtuin 3 (SIRT3) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
Application: IHC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: RUO
Guarantees: This product carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HSIRT3 | Sir2-like 3 | SIR2-like protein 3 | SIRT3 | SIR2L3 | Sirtuin 3 | Sirtuin type 3
Recommended Dilution: IHC-P: 1:100
UniProt Number: Q9NTG7
NCBI GenBank: NM_012239, NP_036371.1
SwissProt: Q9NTG7

Target

Target: SIRT3 / Sirtuin 3
Antigen Species: Hu
Specificity: Human SIRT3 / Sirtuin 3
Epitope: Human SIRT3 / Sirtuin 3
Gene Name: SIRT3

Antibody

Host Species: Rb
Clonality: Polyclonal
Origin Species: Hu

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human SIRT3 (NP_036371.1). QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK