Polyclonal Chicken GFP Antibody (clone IQGFP6 Polyclonal, WB)
Catalog Number: LS-C827997-50
50 µL (1 mg/mL) / $492.00
Antibody: Chicken Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Western Blot
Format: Liquid
Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC-plus™ Polyclonal Rabbit anti-Human SIRT3 / Sirtuin 3 Antibody (IHC, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$383.00each
Catalog Number: LS-B13905-50
Catalog Number: LS-B13905
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Sirtuin 3 antibody LS-B13905 is an unconjugated rabbit polyclonal antibody to Sirtuin 3 (SIRT3) from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.
- Application
- IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HSIRT3 | Sir2-like 3 | SIR2-like protein 3 | SIRT3 | SIR2L3 | Sirtuin 3 | Sirtuin type 3
- Recommended Dilution: IHC-P
- 1:100
- UniProt Number
- Q9NTG7
- NCBI GenBank
- NM_012239 | NP_036371.1
- SwissProt
- Q9NTG7
Target
- Target
- SIRT3 / Sirtuin 3
- Antigen Species
- Human
- Specificity
- Human SIRT3 / Sirtuin 3
- Epitope
- Human SIRT3 / Sirtuin 3
- Gene Name
- SIRT3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human SIRT3 (NP_036371.1). QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 50 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Short term: -20°C; Long term: -80°C; Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
