Polyclonal Chicken GFP Antibody (clone IQGFP6 Polyclonal, WB)
Catalog Number: LS-C827997-50
50 µL (1 mg/mL) / $492.00
Antibody: Chicken Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Western Blot
Format: Liquid
Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC-plus™ Polyclonal Rabbit anti-Human DDIT3 / CHOP Antibody (IHC, IF, WB)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunofluorescence, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$470.00each
Catalog Number: LS-B12888-50
Catalog Number: LS-B12888
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- CHOP antibody LS-B12888 is an unconjugated rabbit polyclonal antibody to CHOP (DDIT3) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.
- Application
- IF, IHC, IHC-P, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This product carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CHOP10 | DDIT-3 | CHOP | GADD153 | C/EBP zeta | C/EBP-homologous protein | C/EBP-homologous protein 10 | CHOP-10 | DDIT3
- Recommended Dilution: IF/ICC
- 1:50 - 1:100
- Recommended Dilution: IHC
- 1:50 - 1:200
- Recommended Dilution: IHC-P
- 1:200
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- P35638
- NCBI GenBank
- NM_004083 | NP_004074.2
- SwissProt
- P35638
Target
- Target
- DDIT3 / CHOP
- Antigen Species
- Human
- Specificity
- Human DDIT3 / CHOP
- Epitope
- Human DDIT3 / CHOP
- Gene Name
- DDIT3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Origin Species
- Human
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence within amino acids 100 to the C-Terminus of human DDIT3 (NP_004074.2). GRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 50 Microliter
- Animal Free
- No
- Carrier-Free
- Yes
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
