GTPase HRAS antibody Western blot. All lanes: Anti GTPase HRAS at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Brain Tissue Lysate at 50 ug. Lane 3: HEPA Whole Cell Lysate at 40 ug. Lane 4: A549 Whole Cell Lysate at 40 ug. Predicted band size: 21 kD. Observed band size: 21 kD.
HRAS / H-Ras Antibody (aa101-137)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Chicken, Guinea Pig, Hamster, Human, Mouse, Rabbit, Rat, Xenopus |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408154-100
Catalog Number: LS-C408154
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- H-Ras antibody LS-C408154 is an unconjugated rabbit polyclonal antibody to H-Ras (HRAS) (aa101-137) from human. It is reactive with human, mouse, rat and other species. Validated for WB.
- Application
- WB
- Reactivity
- Ck, GP, Ham, Hu, Ms, Rb, Rt, Xen
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- C-H-RAS | C-has/bas p21 protein | C-ras-Ki-2 activated oncogene | C-HA-RAS1 | CTLO | H-ras | H-RASIDX | GTP- and GDP-binding peptide B | GTPase HRas | H-Ras-1 | HAMSV | HRAS | HRAS1 | K-RAS | Ha-Ras | Ha-Ras1 proto-oncoprotein | Transforming protein p21 | N-ras | p21ras | RASH1 | C-BAS/HAS | C-ha-ras | p19 H-RasIDX protein
- UniProt Number
- P01112
- NCBI GenBank
- NM_005343, NP_005334.1
- SwissProt
- P01112
Target
- Target
- Human HRAS / H-Ras
- Antigen Species
- Hu
- Epitope
- Widely expressed.
- Gene Name
- HRAS
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human GTPase HRAS (101-137 aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY), identical to the related mouse and rat sequences.
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl