H kDC1 antibody Western blot. All lanes: Anti H kDC1 at 0.5 ug/ml. Lane 1: 293T Whole Cell Lysate at 40 ug. Lane 2: SW620 Whole Cell Lysate at 40 ug. Lane 3: COLO320 Whole Cell Lysate at 40 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Predicted band size: 103 kD. Observed band size: 170 kD.

HKDC1 Antibody (aa102-136)

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human, Non-Human Primate
Format:	Lyophilized

$480.00each

Catalog Number: LS-C357561-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: HKDC1 antibody LS-C357561 is an unconjugated rabbit polyclonal antibody to HKDC1 (aa102-136) from human. It is reactive with human, chimpanzee and orangutan. Validated for WB.
Application: WB
Reactivity: Hu, NHP
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HKDC1 | Putative hexokinase HKDC1 | Hexokinase domain containing 1
UniProt Number: Q2TB90
NCBI GenBank: NM_025130 | NP_079406.3
SwissProt: Q2TB90

Target

Target: Human HKDC1
Antigen Species: Human
Gene Name: HKDC1

Antibody

Host Species: Rabbit
Clonality: Polyclonal

Immunogen

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human HKDC1(102-136 aa KRHVQMESQFYPTPNEIIRGNGTELFEYVADCLAD), different from the related mouse sequence by four amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Concentration: 0.5 mg/mL
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl