Western blot testing of 1) human Caco-2, 2) rat brain and 3) mouse brain lysate with HECTD3 antibody at 0.5ug/ml. Predicted molecular weight ~97 kDa.

HECTD3 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Flow Cytometry, Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782872-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: HECTD3 antibody LS-C782872 is an unconjugated rabbit polyclonal antibody to HECTD3 from human. It is reactive with human, mouse and rat. Validated for Flow, IHC and WB.
Application: FC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HECT domain containing 3 | RP11-69J16.1 | HECTD3
Recommended Dilution: FC: 1 - 3 µg/10E6 cells
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q5T447
NCBI GenBank: NM_024602 | NP_078878.3
SwissProt: Q5T447

Immunogen: Amino acids HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE from the human protein were used as the immunogen for the HECTD3 antibody.

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS