TIM1 antibody Western blot. All lanes: Anti TIM1 at 0.5 ug/ml. Lane 1: HELA Whole Cell Lysate at 40 ug. Lane 2: PANC Whole Cell Lysate at 40 ug. Lane 3: HEPG2 Whole Cell Lysate at 40 ug. Lane 4: A549 Whole Cell Lysate at 40 ug. Predicted band size: 49 kD. Observed band size: 49 kD.
HAVCR1 / KIM-1 Antibody (aa321-359)
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C408148-100
Catalog Number: LS-C408148
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- KIM-1 antibody LS-C408148 is an unconjugated rabbit polyclonal antibody to human KIM-1 (HAVCR1) (aa321-359). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- RUO
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- HAVCR-1 | HAVCR1 | KIM-1 | Kidney injury molecule 1 | KIM1 | T-cell membrane protein 1 | TIM1 | TIMD1 | TIM-1 | HAVCR | TIMD-1 | CD365
- UniProt Number
- Q96D42
- NCBI GenBank
- NM_012206, NP_036338.2
- SwissProt
- Q96D42
Target
- Target
- Human HAVCR1 / KIM-1
- Antigen Species
- Hu
- Epitope
- Widely expressed, with highest levels in kidney and testis. Expressed by activated CD4+ T-cells during the development of helper T-cells responses. .
- Gene Name
- HAVCR1
Antibody
- Host Species
- Rb
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human TIM 1 (321-359 aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD).
- Immunogen Type
- SP-Lin
Format
- Conjugate/Label
- Unconj
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- AP
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl