Western blot analysis of extracts of various cell lines.
GPR68 / OGR1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Human, Mouse, Rat |
| Format: | Liquid |
$293.00each
Catalog Number: LS-C349084-20
Catalog Number: LS-C349084
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- OGR1 antibody LS-C349084 is an unconjugated rabbit polyclonal antibody to OGR1 (GPR68) from human. It is reactive with human, mouse and rat. Validated for WB.
- Application
- IHC, WB
- Reactivity
- Hu, Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Brgrb | G protein-coupled receptor 68 | GPR68 | G-protein coupled receptor 68 | OGR1 | Brgr1 | GPR12A | OGR-1
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q15743
- NCBI GenBank
- NM_003485 | NP_003476.3
- SwissProt
- Q15743
Target
- Target
- Human GPR68 / OGR1
- Antigen Species
- Human
- Epitope
- Human GPR68 / OGR1
- Gene Name
- GPR68
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3). SFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFPTGRLA
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS