Western blot testing of human 1) HeLa, 2) COLO320, 3) A549, 4) PANC-1, 5) A431, 6) Jurkat and 7) 293T cell lysate with Elf-1 antibody at 0.5ug/ml. Expected molecular weight: ~68 kDa (unmodified) up to ~80 kDa (phosphorylated/glycosylated cytoplasmic form) and up to ~98 kDa (phosphorylated/glycosylated nuclear form).

ELF1 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782096-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ELF1 antibody LS-C782096 is an unconjugated rabbit polyclonal antibody to human ELF1. Validated for WB.
Application: WB
Reactivity: Hu
Predicted Reactivity: Mouse, Rat
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ELF1 | E74-like factor 1
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: P32519
NCBI GenBank: NM_172373 | NP_758961.1
SwissProt: P32519

Target

Target: Human ELF1
Antigen Species: Human
Gene Name: ELF1

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE were used as the immunogen for the Elf-1 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS