Western blot - Anti-E74 like factor 1 Picoband antibody

ELF1 Antibody

Name: ELF1 Antibody
Brand: LSBio
SKU: LS-C662769-100
Price: 480 USD
Availability: InStock

$480.00each

Catalog Number: LS-C662769-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: ELF1 antibody LS-C662769 is an unconjugated rabbit polyclonal antibody to human ELF1. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ELF1 | E74-like factor 1
UniProt Number: P32519
NCBI GenBank: NM_172373 | NP_758961.1
SwissProt: P32519

Target: Human ELF1
Antigen Species: Human
Epitope: In fetal tissues, it is highly expressed in heart, lung liver and kidney, and weakly expressed in brain. In adult, it is highly expressed in pancreas, spleen, thymus and peripheral blood leukocytes, expressed at moderate levels in heart, placenta, lung, liver, skeletal muscle, kidney, prostate, ovary, small intestine and colon, and weakly expressed in brain and testis.
Gene Name: ELF1

Immunogen: A synthetic peptide corresponding to a sequence of human E74 like factor 1 (QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE).
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Preservative: Yes

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl