Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
EGFL7 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Immunohistochemistry (general), Western Blot |
| Reactivity: | Mouse, Rat |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C410910-20
Catalog Number: LS-C410910
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- EGFL7 antibody LS-C410910 is an unconjugated rabbit polyclonal antibody to EGFL7 from human. It is reactive with mouse and rat. Validated for IHC and WB.
- Application
- IHC, WB
- Reactivity
- Ms, Rt
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- EGF-like-domain, multiple 7 | EGFL7 | RP11-251M1.2 | VE-STATIN | NOTCH4-like protein | ZNEU1 | EGF-like protein 7 | MEGF7 | Vascular endothelial statin
- Recommended Dilution: IHC
- 1:20 - 1:200
- Recommended Dilution: WB
- 1:200 - 1:2000
- UniProt Number
- Q9UHF1
- NCBI GenBank
- NM_016215 | NP_057299.1
- SwissProt
- Q9UHF1
Target
- Target
- Human EGFL7
- Antigen Species
- Human
- Epitope
- Human EGFL7
- Gene Name
- EGFL7
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human EGFL7 (NP_958854.1). YRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPG
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS
