Western blot analysis of extracts of various cell lines, using DDR2 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 30s.

DDR2 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C496772-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: DDR2 antibody LS-C496772 is an unconjugated rabbit polyclonal antibody to DDR2 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: IHC, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: DDR2 | CD167b antigen | Discoidin domain receptor 2 | Hydroxyaryl-protein kinase | MIG20a | Tyrosine-protein kinase TYRO10 | NTRKR3 | TYRO10 | Tyrosylprotein kinase
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q16832
NCBI GenBank: NM_006182 | NP_006173.2
SwissProt: Q16832

Target

Target: Human DDR2
Antigen Species: Human
Gene Name: DDR2

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 290-400 of human DDR2 (NP_001014796.1). NMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQSDAAMYNNSEALPTSPMAPTTYDPMLKVDDSNTRI
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)