Western blot analysis of extracts of various cell lines, using TFCP2L1 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.
CRTR1 / TFCP2L1 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Liquid |
$281.00each
Catalog Number: LS-C747316-20
Catalog Number: LS-C747316
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- TFCP2L1 antibody LS-C747316 is an unconjugated rabbit polyclonal antibody to human TFCP2L1 (CRTR1). Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- CRTR1 | LBP-9 | TFCP2L1 | CRTR-1 | LBP9 | Transcription factor LBP-9
- Recommended Dilution: WB
- 1:500 - 1:2000
- UniProt Number
- Q9NZI6
- NCBI GenBank
- NM_014553 | NP_055368.1
- SwissProt
- Q9NZI6
Target
- Target
- Human CRTR1 / TFCP2L1
- Antigen Species
- Human
- Gene Name
- TFCP2L1
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Recombinant fusion protein containing a sequence corresponding to amino acids 360-430 of human TFCP2L1 (NP_055368.1). NAIKGRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIANLYSISPQHIH
- Immunogen Type
- Fusion Protein (e.g., GST, MBP tag)
Format
- Conjugate/Label
- Unconjugated
- Format
- Liquid
- Formulation
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Volume
- 20 Microliter
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- Store at -20°C. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- PBS