Western blot analysis of extracts of various cell lines, using CBFA2T3 antibody at 1:1000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.

CBFA2T3 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C749694-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: CBFA2T3 antibody LS-C749694 is an unconjugated rabbit polyclonal antibody to human CBFA2T3. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ETO2 | MTG8-related gene 2 | MTGR2 | MTG16 | MTG8-related protein 2 | Protein CBFA2T3 | Translocated to, 3 | ZMYND4 | CBFA2T3 | HMTG16
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: O75081
NCBI GenBank: NM_005187 | NP_005178.4
SwissProt: O75081

Target

Target: Human CBFA2T3
Antigen Species: Human
Gene Name: CBFA2T3

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 305-390 of human CBFA2T3 (NP_005178.4). DRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHPDPRELRERHRPLVVPGSRQEEVIDHKLTER
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)