Western blot testing of 1) rat thymus, 2) mouse thymus, 3) mouse Hepa1-6, 3) human HeLa, 4) human MCF7 lysate with Bax antibody at 0.5ug/ml. Predicted molecular weight: 21-24 kDa.

BAX Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Flow Cytometry, Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782808-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: BAX antibody LS-C782808 is an unconjugated rabbit polyclonal antibody to BAX from human. It is reactive with human, mouse and rat. Validated for Flow, IHC and WB.
Application: FC, IHC-P, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: BAX | BCL2-associated X protein | Bcl2-L-4 | Apoptosis regulator BAX | Bcl-2-like protein 4 | BCL2L4
Recommended Dilution: FC: 1 - 2 µg/10E6 cells
Recommended Dilution: IHC-P: 1 - 2 µg/ml
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q07812
NCBI GenBank: NM_004324 | NP_004315.1
SwissProt: Q07812

Target

Target: Human BAX
Antigen Species: Human
Gene Name: BAX

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS