Western blot - Anti-Bax Picoband Antibody

BAX Antibody

Antibody:	Rabbit Polyclonal
Applications:	Flow Cytometry, Immunohistochemistry, Paraffin, Western Blot
Reactivity:	Human
Format:	Lyophilized

$480.00each

Catalog Number: LS-C661935-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: BAX antibody LS-C661935 is an unconjugated rabbit polyclonal antibody to human BAX. Validated for Flow, IHC and WB.
Application: FC, IHC-P, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: BAX | BCL2-associated X protein | Bcl2-L-4 | Apoptosis regulator BAX | Bcl-2-like protein 4 | BCL2L4
Recommended Dilution: IHC-P: 0.5 - 1 µg/ml
Recommended Dilution: WB: 0.1 - 0.5 µg/ml
UniProt Number: Q07812
NCBI GenBank: NM_004324 | NP_004315.1
SwissProt: Q07812

Target: Human BAX
Antigen Species: Human
Epitope: Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro- myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T- cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines. .
Gene Name: BAX

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human Bax (17-48 aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl