Western blot of extracts of HeLa cell line, using ATR antibody.

ATR Antibody

Antibody:	Rabbit Polyclonal
Applications:	Immunohistochemistry (general), Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C346310-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: ATR antibody LS-C346310 is an unconjugated rabbit polyclonal antibody to human ATR. Validated for WB.
Application: IHC, WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ATR | FRAP-related protein-1 | FCTCS | SCKL1 | MEC1 | Protein kinase ATR | Rad3 related protein | SCKL | FRAP-related protein 1 | FRP1 | XATR | Serine/threonine-protein kinase ATR | Ataxia telangiectasia and Rad3-related protein | mitosis entry checkpoint 1
Recommended Dilution: WB: 1:500 - 1:2000
UniProt Number: Q13535
NCBI GenBank: NM_001184 | NP_001175.2
SwissProt: Q13535

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1400-1500 of human ATR (NP_001175.2). LTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGHQLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSASWAGYLIT
Immunogen Type: Synthetic Peptide (Linear)