Western blot analysis of extracts of various cells.

ALDH7A1 Antibody

Name: ALDH7A1 Antibody
Brand: LSBio
SKU: LS-C410163-20
Price: 281 USD
Availability: InStock

$281.00each

Catalog Number: LS-C410163-20

Unit Size

Quantity

For bulk orders or custom formulations:

Description: ALDH7A1 antibody LS-C410163 is an unconjugated rabbit polyclonal antibody to ALDH7A1 from human. It is reactive with human, mouse and rat. Validated for WB.
Application: WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: 26g turgor protein homolog | ALDH7A1 | EPD | PDE | Alpha-AASA dehydrogenase | Antiquitin-1 | ATQ1 | Betaine aldehyde dehydrogenase | p6c dehydrogenase
Recommended Dilution: WB: 1:1000 - 1:4000
UniProt Number: P49419
NCBI GenBank: NM_001182 | NP_001173.2
SwissProt: P49419

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 430-539 of human ALDH7A1 (NP_001173.2). APILYVFKFKNEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)