Western blot testing of human 1) HeLa and 2) K562 cell lysate with ADAM28 antibody at 0.5ug/ml. Predicted molecular weight: ~87 kDa (form LM) and ~61 kDa (form LS).

ADAM28 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Lyophilized

$587.00each

Catalog Number: LS-C782821-100

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ADAM28 antibody LS-C782821 is an unconjugated rabbit polyclonal antibody to human ADAM28. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ADAM28 | Disintegrin 1 | Dtgn1 | ADAM 28 | EMDCII | EMDC II | MDC-L | MDC-Ls | MDCL | MDC-Lm
Recommended Dilution: WB: 0.5 - 1 µg/ml
UniProt Number: Q9UKQ2
NCBI GenBank: NM_014265 | NP_055080.2
SwissProt: Q9UKQ2

Target

Target: Human ADAM28
Antigen Species: Human
Gene Name: ADAM28

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Amino acids 207-248 (EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH) from the human protein were used as the immunogen for the ADAM28 antibody.

Format

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from PBS, 2.5% BSA, 0.025% sodium azide.
Preservative: Yes
Purification Method: Affinity Purified

Storage & Handling

Storage Conditions: After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
Recommended Storage Buffer: PBS