Western blot - Anti-ADAM28 Picoband Antibody

ADAM28 Antibody

Name: ADAM28 Antibody
Brand: LSBio
SKU: LS-C662251-100
Price: 480 USD
Availability: InStock

$480.00each

Catalog Number: LS-C662251-100

Unit Size

Quantity

For bulk orders or custom formulations:

Description: ADAM28 antibody LS-C662251 is an unconjugated rabbit polyclonal antibody to human ADAM28. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: ADAM28 | Disintegrin 1 | Dtgn1 | ADAM 28 | EMDCII | EMDC II | MDC-L | MDC-Ls | MDCL | MDC-Lm
UniProt Number: Q9UKQ2
NCBI GenBank: NM_014265 | NP_055080.2
SwissProt: Q9UKQ2

Target: Human ADAM28
Antigen Species: Human
Epitope: Expressed predominantly in secondary lymphoid tissues, such as lymph node, spleen, small intestine, stomach, colon, appendix and trachea. The lymphocyte population is responsible for expression of this protein in these tissues. Isoform 2 is expressed preferentially in spleen.
Gene Name: ADAM28

Immunogen: A synthetic peptide corresponding to a sequence at the N-Terminus of human ADAM28 (207-248 aa EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH), different from the related mouse sequence by eleven amino acids.
Immunogen Type: Synthetic Peptide (Linear)

Conjugate/Label: Unconjugated
Format: Lyophilized
Formulation: Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Preservative: Yes
Purification Method: Affinity Purified

Storage Conditions: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Recommended Storage Buffer: NaCl