Western blot analysis of extracts of various cell lines, using ACTN3 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 5s.

ACTN3 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Immunofluorescence, Western Blot
Reactivity:	Human, Mouse, Rat
Format:	Liquid

$281.00each

Catalog Number: LS-C747933-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ACTN3 antibody LS-C747933 is an unconjugated rabbit polyclonal antibody to ACTN3 from human. It is reactive with human, mouse and rat. Validated for IF and WB.
Application: IF, WB
Reactivity: Hu, Ms, Rt
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: Actinin, alpha 3 | Alpha-actinin skeletal muscle | Alpha-actinin-3 | ACTN3 | F-actin cross-linking protein
Recommended Dilution: IF/ICC: 1:50 - 1:200
Recommended Dilution: WB: 1:1000 - 1:2000
UniProt Number: Q08043
NCBI GenBank: NM_001104 | NP_001095.2
SwissProt: Q08043

Target

Target: Human ACTN3
Antigen Species: Human
Gene Name: ACTN3

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG
Origin Species: Human

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 580-630 of human ACTN3 (NP_001095.2). GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)