Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot - Anti-ACTN3/Alpha Actinin 3 Picoband Antibody
ACTN3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Flow Cytometry, Immunocytochemistry, Immunohistochemistry (general), Immunohistochemistry, Paraffin, Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$480.00each
Catalog Number: LS-C661871-100
Catalog Number: LS-C661871
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ACTN3 antibody LS-C661871 is an unconjugated rabbit polyclonal antibody to human ACTN3. Validated for Flow, ICC, IHC and WB.
- Application
- FC, ICC, IHC, IHC-P, WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Actinin, alpha 3 | Alpha-actinin skeletal muscle | Alpha-actinin-3 | ACTN3 | F-actin cross-linking protein
- UniProt Number
- Q08043
- NCBI GenBank
- NM_001104 | NP_001095.2
- SwissProt
- Q08043
Target
- Target
- Human ACTN3
- Antigen Species
- Human
- Epitope
- Expressed only in a subset of type 2 skeletal muscle fibers. .
- Gene Name
- ACTN3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
Immunogen
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-Terminus of human ACTN3 (574-617 aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
- Immunogen Type
- Synthetic Peptide (Linear)
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
- Recommended Storage Buffer
- NaCl
