LSBio The Immunohistochemistry Antibody Company
  • Home
  • Antibodies
    • Primary Antibodies
    • Secondary Antibodies
    • IHC-plus Antibodies
    • Isotype Control Antibodies
    • Blocking Peptides
  • ELISA Kits
    • All Kits
    • Sandwich ELISA Kits
    • EIA Kits
    • Cell-Based ELISA Kits
    • DNA-Binding ELISA Kits
  • Services
    • Immunohistochemistry Studies
    • Tissue Cross-Reactivity Screening
  • Distributors
  • Resources
    • About our Tissue Bank
    • Customer Support
    • How to Buy
    • IHC-plus Protocol
    • LSBio Media
    • Publications
    • Antibody Reports
  • Company
    • About LifeSpan
    • Press Releases
    • Holiday Schedule
    • Contact Us
  • View Cart

Unfortunately, the antibody LS-C277348 is no longer available.

Below is a list of antibodies to the same protein target. You may also try your search again using the search box at the top of the page. Please contact us if you have any questions.



SLIM / FHL1 Antibodies

four and a half LIM domains 1

Gene Name: four and a half LIM domains 1
Synonyms: FHL1 Antibody, BA535K18.1 Antibody, FHL1B Antibody, FHL1A Antibody, FLH1A Antibody, Four and a half LIM domains 1 Antibody, FHL-1 Antibody, KYOT Antibody, Skeletal muscle LIM-protein 1 Antibody, SLIM-1 Antibody, Skeletal muscle LIM-protein1 Antibody, SLIMMER Antibody, XMPMA Antibody, KYO-T Antibody, LIM protein SLIMMER Antibody, SLIM Antibody, SLIM1 Antibody
Target Sequences: NM_001449 NP_001440.2 Q13642
 SLIM / FHL1 Feature Table
Featured Image

Featured SLIM / FHL1 Antibody

LS-B2495 is a goat polyclonal antibody that LifeSpan has tested extensively in immunohistochemistry (IHC) and is an excellent antibody for use in formalin-fixed paraffin embedded tissues. Multiple tissues were immunolabeled and the results were interpreted by a LifeSpan pathologist. This image shows an example of staining in formalin-fixed paraffin embedded tissue. Learn more about our IHC Validation procedure. All LSBio antibodies are 100% guaranteed.

Publications (1)

1
Adenylyl cyclase 6 deletion reduces left ventricular hypertrophy, dilation, dysfunction, and fibrosis in pressure-overloaded female mice. Tang T, Lai NC, Hammond HK, Roth DM, Yang Y, Guo T, Gao MH. Journal of the American College of Cardiology. 2010 55:1476-86. [PubMed:20359598] [PMC:PMC3081694] Related Antibodies: LS-B2495.

SLIM / FHL1 Antibodies (15)

Target Reactivity Applications Host Isotype Clonality Clone Format Epitope Publications Type
SLIM / FHL1 Goat Polyclonal Unconjugated Human, Mouse, Rat, Hamster IHC-P, WB, ELISA Internal Yes Primary
Anti-SLIM / FHL1 Antibody (Internal) IHC-plus™ LS-B2495
PublicationsPublications (1)
IHC Image
WB Image
Goat Polyclonal to Human SLIM / FHL1
Human, Mouse, Rat, Hamster
IHC - Paraffin, Western blot, ELISA
Unconjugated
SLIM / FHL1 Rabbit IgG Polyclonal Unconjugated Human, Chimpanzee, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Rabbit, Sheep IHC-P, WB aa51-100 No Primary
Anti-SLIM / FHL1 Antibody (aa51-100) IHC-plus™ LS-B3484
IHC Image
IHC Image
Rabbit Polyclonal (IgG) to Human SLIM / FHL1
Human, Chimpanzee, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Pig, Rabbit, Sheep
IHC - Paraffin, Western blot
Unconjugated
SLIM / FHL1 Rabbit IgG Monoclonal EPR7520 Unconjugated Human, Mouse, Rat IHC-P, WB, IP Internal No Primary
Anti-SLIM / FHL1 Antibody (Internal, clone EPR7520) LS-C154607
IHC Image
IHC Image
Rabbit Monoclonal [clone EPR7520] (IgG) to Human SLIM / FHL1
Human, Mouse, Rat
IHC - Paraffin, Western blot, Immunoprecipitation
Unconjugated
SLIM / FHL1 Rabbit Polyclonal Unconjugated Human IHC-P, WB, Flo aa220-249 No Primary
Anti-SLIM / FHL1 Antibody (aa220-249) LS-C166150
IHC Image
Flo Image
Rabbit Polyclonal to Human SLIM / FHL1
Human
IHC - Paraffin, Western blot, Flow Cytometry
Unconjugated
SLIM / FHL1 Rabbit Polyclonal Unconjugated Human IHC, WB, ELISA aa18-261 No Primary
Anti-SLIM / FHL1 Antibody (aa18-261) LS-C179177
IHC Image
Rabbit Polyclonal to Human SLIM / FHL1
Human
IHC, Western blot, ELISA
Unconjugated
SLIM / FHL1 Rabbit IgG Polyclonal Unconjugated Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep IHC, WB aa207-256 No Primary
Anti-SLIM / FHL1 Antibody (aa207-256) LS-C30688
IHC Image
WB Image
Rabbit Polyclonal (IgG) to Human SLIM / FHL1
Human, Chimpanzee, Orangutan, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Sheep
IHC, Western blot
Unconjugated
SLIM / FHL1 Mouse IgG2a,k Monoclonal 2A9 Unconjugated Human, Mouse, Rat WB, ELISA No Primary
Anti-SLIM / FHL1 Antibody (clone 2A9) LS-C197221
WB Image
WB Image
Mouse Monoclonal [clone 2A9] (IgG2a,k) to Human SLIM / FHL1
Human, Mouse, Rat
Western blot, ELISA
Unconjugated
SLIM / FHL1 Mouse IgG1 Monoclonal 2E11 Unconjugated Human, Rat, Dog IF, WB, Flo No Primary
Anti-SLIM / FHL1 Antibody (clone 2E11) LS-C172314
IF Image
Flo Image
Mouse Monoclonal [clone 2E11] (IgG1) to Human SLIM / FHL1
Human, Rat, Dog
Immunofluorescence, Western blot, Flow Cytometry
Unconjugated
SLIM / FHL1 Mouse IgG1 Monoclonal 1D6 Unconjugated Human WB, Flo No Primary
Anti-SLIM / FHL1 Antibody (clone 1D6) LS-C115303
Flo Image
Flo Image
Mouse Monoclonal [clone 1D6] (IgG1) to Human SLIM / FHL1
Human
Western blot, Flow Cytometry
Unconjugated
SLIM / FHL1 Mouse IgG1 Monoclonal 2E1 Unconjugated Human IF, WB, Flo No Primary
Anti-SLIM / FHL1 Antibody (clone 2E1) LS-C115289
IF Image
Flo Image
Mouse Monoclonal [clone 2E1] (IgG1) to Human SLIM / FHL1
Human
Immunofluorescence, Western blot, Flow Cytometry
Unconjugated
SLIM / FHL1 Mouse IgG1 Monoclonal 3H3 Unconjugated Human IF, WB, Flo No Primary
Anti-SLIM / FHL1 Antibody (clone 3H3) LS-C115366
IF Image
Flo Image
Mouse Monoclonal [clone 3H3] (IgG1) to Human SLIM / FHL1
Human
Immunofluorescence, Western blot, Flow Cytometry
Unconjugated
SLIM / FHL1 Goat Polyclonal Unconjugated Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Dog, Pig, Rabbit WB, ELISA Internal No Primary
Anti-SLIM / FHL1 Antibody (Internal) LS-C55478
WB Image
Goat Polyclonal to Human SLIM / FHL1
Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Dog, Pig, Rabbit
Western blot, ELISA
Unconjugated
SLIM / FHL1 Mouse IgG2a Monoclonal 10C236 Unconjugated, Azide-free Human WB, ELISA aa23-121 No Primary
Anti-SLIM / FHL1 Antibody (aa23-121, clone 10C236, Azide-free) LS-C183622
Mouse Monoclonal [clone 10C236] (IgG2a) to Human SLIM / FHL1
Human
Western blot, ELISA
Unconjugated, Azide-free
SLIM / FHL1 Goat IgG Polyclonal Unconjugated Human WB aa93-166 No Primary
Anti-SLIM / FHL1 Antibody (aa93-166) LS-C191445
Goat Polyclonal (IgG) to Human SLIM / FHL1
Human
Western blot
Unconjugated
SLIM / FHL1 Rabbit IgG Polyclonal Unconjugated Human WB No Primary
Anti-SLIM / FHL1 Antibody LS-C311143
Rabbit Polyclonal (IgG) to Human SLIM / FHL1
Human
Western blot
Unconjugated

SLIM / FHL1 Feature Table


Feature Type Location Details
alternative products 1 - 323 Event=Alternative splicing; Named isoforms=3; Name=2; Synonyms=FHL1B, SLIMMER; IsoId=Q13642-2; Sequence=Displayed; Name=1; Synonyms=FHL1, FHL1A, SLIM1; IsoId=Q13642-1; Sequence=VSP_010694; Name=3; Synonyms=FHL1C; IsoId=Q13642-3; Sequence=VSP_010693;
developmental stage 1 - 323 Elevated levels during postnatal muscle growth.
Disease 1 - 323 Defects in FHL1 are the cause of X-linked childhood-onset reducing body myopathy (RBM) [MIM:300718]. This disorder is allelic to severe early-onset reducing body myopathy (RBM) [MIM:300717].
Disease 1 - 323 Defects in FHL1 are the cause of X-linked dominant scapuloperoneal myopathy [MIM:300695]. Scapuloperoneal syndrome (SPS) was initially described more than 120 years ago by Jules Broussard as 'une forme hereditaire d'atrophie musculaire progressive' beginning in the lower legs and affecting the shoulder region earlier and more severely than distal arm. The etiology of this condition remains unclear.
Disease 1 - 323 Defects in FHL1 are the cause of X-linked myopathy with postural muscle atrophy (XMPMA) [MIM:300696]. Myopathies are inherited muscle disorders characterized by weakness and atrophy of voluntary skeletal muscle, and several types of myopathy also show involvement of cardiac muscle. XMPMA is a distinct form of adult-onset X-linked recessive myopathy with several features in common with other myopathies, but the presentation of a pseudoathletic phenotype, scapuloperoneal weakness, and bent spine is unique and might render the clinical phenotype distinguishable from other myopathies.
Disease 1 - 323 Defects in FHL1 are the cause of X-linked severe early- onset reducing body myopathy (RBM) [MIM:300717]. RBM is a rare muscle disorder causing progressive muscular weakness and characteristic intracytoplasmic inclusions in myofibers. Clinical presentations of RBM have ranged from early onset fatal to childhood onset to adult onset cases.
Function 1 - 323 May have an involvement in muscle development or hypertrophy.
interaction 1 - 323 P48552:NRIP1; NbExp=5; IntAct=EBI-1052757, EBI-746484; P04156:PRNP; NbExp=1; IntAct=EBI-1052757, EBI-977302;
sequence caution 1 - 323 Sequence=AAH88369.1; Type=Erroneous initiation; Sequence=CAI41055.1; Type=Erroneous initiation;
Similarity 1 - 323 Contains 3 LIM zinc-binding domains.
Subcellular Location 1 - 323 Isoform 1: Cytoplasm.
Subcellular Location 1 - 323 Isoform 2: Nucleus. Cytoplasm, cytosol. Note=Predominantly nuclear in myoblasts but is cytosolic in differentiated myotubes.
Subcellular Location 1 - 323 Isoform 3: Cytoplasm. Nucleus.
Tissue Specificity 1 - 323 Isoform 1 is highly expressed in skeletal muscle and to a lesser extent in heart, placenta, ovary, prostate, testis, small intestine, colon and spleen. Expression is barely detectable in brain, lung, liver, kidney, pancreas, thymus and peripheral blood leukocytes. Isoform 2 is expressed in brain, skeletal muscle and to a lesser extent in heart, colon, prostate and small intestine. Isoform 3 is expressed in testis, heart and skeletal muscle.
arrayexpress 1 - 323 Q13642
bgee 1 - 323 Q13642
ctd 1 - 323 2273
doi 1 - 323 10
eggnog 1 - 323 prNOG14953
embl 1 - 323 AF063002
embl 1 - 323 AF098518
embl 1 - 323 AF110763
embl 1 - 323 AF220153
embl 1 - 323 AL078638
embl 1 - 323 BC010998
embl 1 - 323 BC088369
embl 1 - 323 U29538
embl 1 - 323 U60115
embl 1 - 323 U60118
ensembl 1 - 323 ENST00000345434
ensembl 1 - 323 ENST00000394155
gene3d 1 - 323 G3DSA:2.10.110.10
genecards 1 - 323 GC0XP135229
geneid 1 - 323 2273
genevestigator 1 - 323 Q13642
germonline 1 - 323 ENSG00000022267
go 1 - 323 GO:0005515
go 1 - 323 GO:0005634
go 1 - 323 GO:0005829
go 1 - 323 GO:0007517
go 1 - 323 GO:0008270
go 1 - 323 GO:0009887
go 1 - 323 GO:0016049
go 1 - 323 GO:0030154
hgnc 1 - 323 HGNC:3702
hovergen 1 - 323 HBG074526
hpa 1 - 323 CAB020817
hpa 1 - 323 HPA001040
hpa 1 - 323 HPA001391
inparanoid 1 - 323 Q13642
intact 1 - 323 Q13642
interpro 1 - 323 IPR001781
ipi 1 - 323 IPI00055606
ipi 1 - 323 IPI00644668
ipi 1 - 323 IPI00647207
kegg 1 - 323 hsa:2273
medline 1 - 323 22608298
medline 1 - 323 95352104
medline 1 - 323 96354835
medline 1 - 323 98382585
medline 1 - 323 99282525
medline 1 - 323 99410448
medline 1 - 323 99453782
mim 1 - 323 300163
mim 1 - 323 300695
mim 1 - 323 300696
mim 1 - 323 300717
mim 1 - 323 300718
nextbio 1 - 323 9243
orphanet 1 - 323 178461
orphanet 1 - 323 85146
orphanet 1 - 323 97239
orthodb 1 - 323 EOG983GPV
pdb 1 - 323 1X63
pdb 1 - 323 2CUP
pdb 1 - 323 2CUR
pdb 1 - 323 2EGQ
pdbsum 1 - 323 1X63
pdbsum 1 - 323 2CUP
pdbsum 1 - 323 2CUR
pdbsum 1 - 323 2EGQ
pfam 1 - 323 PF00412
pharmgkb 1 - 323 PA29265
phylomedb 1 - 323 Q13642
pir 1 - 323 G01884
pir 1 - 323 JC4893
pride 1 - 323 Q13642
prosite 1 - 323 PS00478
prosite 1 - 323 PS50023
proteinmodelportal 1 - 323 Q13642
pubmed 1 - 323 10352231
pubmed 1 - 323 10480922
pubmed 1 - 323 10524257
pubmed 1 - 323 11400158
pubmed 1 - 323 12665801
pubmed 1 - 323 15489334
pubmed 1 - 323 15772651
pubmed 1 - 323 18179888
pubmed 1 - 323 18179901
pubmed 1 - 323 18274675
pubmed 1 - 323 7626119
pubmed 1 - 323 8753811
pubmed 1 - 323 9714789
refseq 1 - 323 NP_001153171.1
refseq 1 - 323 NP_001153172.1
refseq 1 - 323 NP_001153173.1
refseq 1 - 323 NP_001153174.1
refseq 1 - 323 NP_001153175.1
refseq 1 - 323 NP_001153176.1
refseq 1 - 323 NP_001161291.1
refseq 1 - 323 NP_001440.2
smart 1 - 323 SM00132
smr 1 - 323 Q13642
string 1 - 323 Q13642
ucsc 1 - 323 uc004ezo.1
ucsc 1 - 323 uc004ezq.1
unigene 1 - 323 Hs.435369
alt_init; genomic_dna 1 - 323 CAI41055.1
alt_init; mrna 1 - 323 AAH88369.1
chain 2 - 323 Four and a half LIM domains protein 1 /FTId=PRO_0000075735.
conflict 73 - 73 H -> Q (in Ref. 1; AAC52021)
conflict 81 - 91 VAKDNKILCNK -> CGQGQQRSCAQ (in Ref. 4; AAD21579).
conflict 98 - 98 S -> F (in Ref. 1 and 4)
conflict 158 - 158 F -> L (in Ref. 1 and 10)
conflict 239 - 239 H -> R (in Ref. 5; AAC72390)
domain 40 - 92 LIM zinc-binding 1
domain 101 - 153 LIM zinc-binding 2
domain 162 - 212 LIM zinc-binding 3
init_met 1 - 1 Removed
var_seq 168 - 296 Missing (in isoform 3) /FTId=VSP_010693.
var_seq 231 - 323 KRTVSRVSHPVSKARKPPVCHGKRLPLTLFPSANLRGRHPG GERTCPSWVVVLYRKNRSLAAPRGPGLVKAPVWWPMKDNPG TTTASTAKNAP -> FGKGSSVVAYEGQSWHDYCFHCKKCS VNLANKRFVFHQEQVYCPDCAKKL (in isoform 1). /FTId=VSP_010694.
variant 122 - 122 W -> S (in X-linked dominant scapuloperoneal myopathy). /FTId=VAR_042603.
variant 123 - 123 H -> Y (in RBM; X-linked severe early- onset; the mutant protein initiates aggregation of the FHL1 protein, forms reducing bodies and traps wild-type FHL1 into the inclusion bodies; consistent with a dominant-negative effect). /FTId=VAR_045999.
variant 128 - 128 T -> TI (in XMPMA) /FTId=VAR_042604.
variant 132 - 132 C -> F (in RBM; X-linked severe early- onset; the mutant protein initiates aggregation of the FHL1 protein, forms reducing bodies and traps wild-type FHL1 into the inclusion bodies; consistent with a dominant-negative effect). /FTId=VAR_046000.
variant 153 - 153 C -> R (in RBM; X-linked childhood- onset). /FTId=VAR_046001.
variant 153 - 153 C -> Y (in RBM; X-linked childhood- onset). /FTId=VAR_046002.
variant 224 - 224 C -> W (in XMPMA) /FTId=VAR_042605.
zn_fing 7 - 31 C4-type (Potential)
keyword 1 - 323 3D-structure
keyword 1 - 323 Alternative splicing
keyword 1 - 323 Cardiomyopathy
keyword 1 - 323 Complete proteome
keyword 1 - 323 Cytoplasm
keyword 1 - 323 Developmental protein
keyword 1 - 323 Differentiation
keyword 1 - 323 Direct protein sequencing
keyword 1 - 323 Disease mutation
keyword 1 - 323 LIM domain
keyword 1 - 323 Metal-binding
keyword 1 - 323 Nucleus
keyword 1 - 323 Repeat
keyword 1 - 323 Zinc
keyword 1 - 323 Zinc-finger
Molecular Weight 1 - 323 36263
3 hits 1 - 323 PF00412
3 hits 1 - 323 PS00478
3 hits 1 - 323 PS50023

If you do not find the reagent or information you require, please contact customer.support@lsbio.com to inquire about additional products in development.

PLEASE NOTE

For RESEARCH USE ONLY. Not intended for human diagnostic or therapeutic purposes.

The data on this page has been compiled from LifeSpan internal sources, the National Center for Biotechnology Information (NCBI), and The Universal Protein Resource (UniProt).


Get Social With Us! Follow us on Facebook Follow us on Google+ Follow us on LinkedIn
Copyright © 2014 LifeSpan BioSciences, Inc. All Rights Reserved Privacy Policy