Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C756667-10 10 µg $318 
LS-C756667-100 100 µg $470 
HSPA2 Antibody - IHC analysis of HSPA2 using anti-HSPA2 antibody. HSPA2 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-HSPA2 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
HSPA2 Antibody - IF analysis of HSPA2 using anti-HSPA2 antibody HSPA2 was detected in immunocytochemical section of PC-3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSPA2 antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSPA2 Antibody - Western blot analysis of HSPA2 using anti-HSPA2 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysate, Lane 2: human MDA-MB-231 whole cell lysate,Lane 3: human COLO-320 whole cell lysate,Lane 4: human PANC-1 whole cell lysate. Lane 5: human HT1080 whole cell lysate,Lane 6: human MDA-MB-453 whole cell lysate,Lane 7: human HepG2 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-HSPA2 antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
HSPA2 Antibody - Flow Cytometry analysis of PC-3 cells using anti-HSPA2 antibody. Overlay histogram showing PC-3 cells stained with anti-HSPA2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-HSPA2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
HSPA2 Antibody - IHC analysis of HSPA2 using anti-HSPA2 antibody. HSPA2 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-HSPA2 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
HSPA2 Antibody - IF analysis of HSPA2 using anti-HSPA2 antibody HSPA2 was detected in immunocytochemical section of PC-3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSPA2 antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSPA2 Antibody - Western blot analysis of HSPA2 using anti-HSPA2 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysate, Lane 2: human MDA-MB-231 whole cell lysate,Lane 3: human COLO-320 whole cell lysate,Lane 4: human PANC-1 whole cell lysate. Lane 5: human HT1080 whole cell lysate,Lane 6: human MDA-MB-453 whole cell lysate,Lane 7: human HepG2 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-HSPA2 antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
HSPA2 Antibody - Flow Cytometry analysis of PC-3 cells using anti-HSPA2 antibody. Overlay histogram showing PC-3 cells stained with anti-HSPA2 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-HSPA2 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 4
2 of 4
3 of 4
4 of 4

Monoclonal Mouse anti‑Human HSPA2 Antibody (IHC, WB) LS‑C756667

Monoclonal Mouse anti‑Human HSPA2 Antibody (IHC, WB) LS‑C756667

Antibody:
HSPA2 Mouse anti-Human Monoclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C756667-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
HSPA2 Mouse anti-Human Monoclonal Antibody
Application:
IHC-P, WB
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
HSPA2 antibody LS-C756667 is an unconjugated mouse monoclonal antibody to HSPA2 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
Target
Human HSPA2
Synonyms
HSPA2 | Heat shock 70kD protein 2 | HSP70-2 | HSP70-3 | Heat shock 70 kDa protein 2 | Heat shock 70kDa protein 2
Host
Mouse
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG1 Monoclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human HSPA2 (564-598 aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
Specificity
No cross reactivity with other proteins.
Applications
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HSPA2
P54652 NM_021979 NP_068814.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 5/3/2024