Products
Research Areas
COVID-19
Resources
Contact Us
Login
Quick Order
Cart
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Cart
How To Buy
Contact Us

Locations

Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers


Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us


Additional Contact Details

Distributors
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Antibodies > EMD / Emerin > LS-C756632
 
Print Page  
Catalog Number Size Price
LS-C756632-10 10 µg $318 
LS-C756632-100 100 µg $470 
EMD / Emerin Antibody - IHC analysis of Emerin using anti-Emerin antibody. Emerin was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-Emerin Antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EMD / Emerin Antibody - IHC analysis of Emerin using anti-Emerin antibody. Emerin was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-Emerin Antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EMD / Emerin Antibody - Western blot analysis of Emerin using anti-Emerin antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysates, Lane 2: human placenta tissue lysates, Lane 3: human Caco-2 whole cell lysates, Lane 4: human HepG2 whole cell lysates,Lane 5: Rabbit IgG, Lane 6: Marker 1113, Lane 7: human Jurkat whole cell lysates. Lane 8: human MDA-MB-453 whole cell lysates, Lane 9: human SK-OV-3 whole cell lysates, Lane 10: human SW620 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Emerin antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a Biotin Conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
EMD / Emerin Antibody - Flow Cytometry analysis of A431 cells using anti-Emerin antibody. Overlay histogram showing A431 cells stained with anti-Emerin antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Emerin Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
EMD / Emerin Antibody - IHC analysis of Emerin using anti-Emerin antibody. Emerin was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-Emerin Antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EMD / Emerin Antibody - IHC analysis of Emerin using anti-Emerin antibody. Emerin was detected in paraffin-embedded section of human gastric cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-Emerin Antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
EMD / Emerin Antibody - Western blot analysis of Emerin using anti-Emerin antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysates, Lane 2: human placenta tissue lysates, Lane 3: human Caco-2 whole cell lysates, Lane 4: human HepG2 whole cell lysates,Lane 5: Rabbit IgG, Lane 6: Marker 1113, Lane 7: human Jurkat whole cell lysates. Lane 8: human MDA-MB-453 whole cell lysates, Lane 9: human SK-OV-3 whole cell lysates, Lane 10: human SW620 whole cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Emerin antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a Biotin Conjugated goat anti-mouse IgG secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
EMD / Emerin Antibody - Flow Cytometry analysis of A431 cells using anti-Emerin antibody. Overlay histogram showing A431 cells stained with anti-Emerin antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Emerin Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 4
2 of 4
3 of 4
4 of 4

Monoclonal Mouse anti‑Human EMD / Emerin Antibody (IHC, WB) LS‑C756632

Monoclonal Mouse anti‑Human EMD / Emerin Antibody (IHC, WB) LS‑C756632

Submit Review LSBio Guarantee
Antibody:
EMD / Emerin Mouse anti-Human Monoclonal Antibody
Application:
IHC-P, IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C756632-10
Toll Free North America
206-374-1102
For Research Use Only
Specifications Validation Publications Reviews Featured Products Request SDS/MSDS

Overview

Antibody:
EMD / Emerin Mouse anti-Human Monoclonal Antibody
Application:
IHC-P, IHC-Fr, ICC, WB, Flo
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
Emerin antibody LS-C756632 is an unconjugated mouse monoclonal antibody to human Emerin (EMD). Validated for Flow, ICC, IHC and WB.
Target
Human EMD / Emerin
Synonyms
EMD | EDMD | Emerin | LEM domain containing 5 | LEMD5 | STA
Host
Mouse
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
IgG1 Monoclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human Emerin (1-48 aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
Specificity
No cross reactivity with other proteins.
Applications
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • IHC - Frozen (0.5 - 1 µg/ml)
  • ICC (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
  • Flow Cytometry (1 - 3 µg/10E6 cells)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About EMD / Emerin
P50402 NM_000117 NP_000108.1

Publications (0)

Submit a Publication for LS-C756632

Customer Reviews (0)

Submit a review for LS-C756632

Featured Products

EMD / Emerin Antibody - Immunofluorescence of monoclonal antibody to EMD on HeLa cell. [antibody concentration 10 ug/ml]
EMD / Emerin Antibody (clone 3B9) LS‑C133167
Species: Human
Applications: Immunofluorescence, Western blot, ELISA
EMD / Emerin Antibody - Anti-EMD / Emerin antibody IHC of human prostate. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.
IHC‑plus™ EMD / Emerin Antibody LS‑B565
Species: Human, Mouse, Rat
Applications: IHC, IHC - Paraffin, Immunofluorescence, Western blot, ELISA
EMD / Emerin Antibody - EMD / Emerin antibody Western blot of MCF7 Cell lysate. Antibody concentration 1 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.
EMD / Emerin Antibody (aa34‑83, Biotin) LS‑C470544
Species: Human, Chimpanzee, Guinea pig, Rabbit
Applications: Western blot
NOTUM ELISA Kit
Human NOTUM (Sandwich ELISA) ELISA Kit - LS-F34267
Reactivity: Human
Range: 78.125-5000 pg/ml
Anti-CMV / Cytomegalovirus antibody (IgG) ELISA Kit
Human Anti-CMV / Cytomegalovirus antibody (IgG) (Direct ELISA) ELISA Kit - LS-F10235
Reactivity: Human
Range: Positive/Negative
IL11RA ELISA Kit
Human IL11RA (Sandwich ELISA) ELISA Kit - LS-F8919
Reactivity: Human
Range: 0.156-10 ng/ml
See all EMD / Emerin Antibodies

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com
Requested From: United States
Date Requested: 5/26/2024
Family of Companies
Site Links Home All Antibodies How To Buy All Proteins Distributors All ELISA & Assay Kits Reviews PathPlus™ Antibodies
Follow LSBio View Cart Register or Login
Copyright © 2022 LifeSpan BioSciences, Inc - Privacy Policy
Contact Us

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464

Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

To place an order:
Orders@LSBio.com

For questions about orders:
Customer.Support@LSBio.com

For technical assistance:
Technical.Support@LSBio.com