DEFB1 / BD-1 Antibody
Catalog Number: LS-C285695
2 sizes / from $300.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Western Blot
Reactivity: Human
Format: Liquid
Purified recombinant protein DEFB1 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Human DEFB1 / BD-1 Protein (Recombinant Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$1130.00each
Catalog Number: LS-G65068-20
Catalog Number: LS-G65068
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Purified Recombinant protein of human defensin, beta 1 (DEFB1).
- Category
- Proteins & Peptides > Proteins > Recombinant Proteins
- Alternative Names
- BD1 | Beta-defensin 1 | BD-1 | Beta Defensin 1 | DEFB-1 | DEFB101 | Defensin | beta 1 | Defensin beta | DEFB1 | HBD-1 | Beta-defensin-1 | HBD1
- Origin Species
- Hu
- NCBI GenBank
- NM_005218
- SwissProt
- P60022
Protein
- Expression System
- HEK293
- Fusion Tag
- FLAG, Myc
- Molecular Weight
- 5 kDa
- Protein Type
- Recombinant
- Amino Acid Sequence
1MRTSYLLLFT LCLLLSEMAS GGNFLTGLGH RSDHYNCVSS GGQCLYSACP IFTKIQGTCY61RGKAKCCKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
68 aa + 31 aa (cloning site & tags)
Format
- Purity
- >80%
- Conjugate/Label
- Unconj
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
- Purity Measurement Method
- SDS-PAGE
Storage & Handling
- Storage Conditions
- Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
