Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
PLGLB2 / PLGLB1 Protein (Over-Expression Lysate Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$504.00each
Catalog Number: LS-G117828-100
Catalog Number: LS-G117828
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- This product includes lysate of HEK293T cells that have been transiently-tranfected with Human PLGLB1(PLGLB2) (NM_002665), cells transfected with the vector alone, and a reducing buffer for SDS-Page gel loading. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4).
- Category
- Proteins & Peptides > Proteins > Lysates
- Alternative Names
- PLGL | PLGLB2 | PRGB | Plasminogen pseudogene 1 | Plasminogen-related protein B | Plasminogen-like B2 | PLGP1 | Type B plasminogen related
- Origin Species
- Human
- SwissProt
- Q02325
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 10.8 kDa
- Protein Type
- Lysate
- Amino Acid Sequence
1MEHKEVVLLL LLFLKSGQGE PLDDYVNTQG PSLFSVTKKQ LGAGSREECA AKCEEDKEFT61CRAFQYHSKE QQCVIMAENR KSSIIIRMRD AVLFEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
96 aa + 31 aa (cloning site & tags)
Format
- Purity
- Unpurified
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- 25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4.
- Concentration
- 1 mg/mL
Storage & Handling
- Storage Conditions
- Store at -80°C. Avoid freeze-thaw cycles. After incubation with SDS-PAGE sample buffer, SDS-PAGE samples need to be stored in -20°C for long term storage.