Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
LD78 / CCL3L1 Protein (Over-Expression Lysate Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$504.00each
Catalog Number: LS-G110819-100
Catalog Number: LS-G110819
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- This product includes lysate of HEK293T cells that have been transiently-tranfected with Human LD78 beta(CCL3L1) (NM_021006), cells transfected with the vector alone, and a reducing buffer for SDS-Page gel loading. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4).
- Category
- Proteins & Peptides > Proteins > Lysates
- Alternative Names
- 464.2 | C-C motif chemokine 3-like 1 | CCL3L1 | D17S1718 | G0S19-2 | LD78 | LD78BETA | SCYA3L | SCYA3L1 | LD78-beta(1-70) | MIP1AP | PAT 464.2
- Origin Species
- Human
- NCBI GenBank
- M24110
- SwissProt
- P16619
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 10.1 kDa
- Protein Type
- Lysate
- Amino Acid Sequence
1MQVSTAALAV LLCTMALCNQ VLSAPLAADT PTACCFSYTS RQIPQNFIAD YFETSSQCSK61PSVIFLTKRG RQVCADPSEE WVQKYVSDLE LSATRTRPLEQKLISEEDLAANDILDYKDDDDKV
93 aa + 31 aa (cloning site & tags)
Format
- Purity
- Unpurified
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- 25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4.
- Concentration
- 1 mg/mL
Storage & Handling
- Storage Conditions
- Store at -80°C. Avoid freeze-thaw cycles. After incubation with SDS-PAGE sample buffer, SDS-PAGE samples need to be stored in -20°C for long term storage.