STRA13 Antibody (FITC)
Catalog Number: LS-C396719
2 sizes / from $300.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay
Reactivity: Human
Format: Liquid
Purified recombinant protein CENPX was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Human STRA13 Protein (Recombinant Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$1130.00each
Catalog Number: LS-G68345-20
Catalog Number: LS-G68345
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Purified Recombinant protein of human stimulated by retinoic acid 13 homolog (mouse) (STRA13).
- Category
- Proteins & Peptides > Proteins > Recombinant Proteins
- Alternative Names
- CENPX | HLHB2 | Stimulated by retinoic acid 13 | STRA13 | MHF2 | CENP-X | Centromere protein X | FAAP10
- Origin Species
- Human
- NCBI GenBank
- U95006
- SwissProt
- A8MT69
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 6.8 kDa
- Protein Type
- Recombinant
- Amino Acid Sequence
1MEGAGAGSGF RKELVSRLLH LHFKDDKTKE AAVRGVRQAQ AEDALRADVD QLEKVLPQLL61LDFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
63 aa + 31 aa (cloning site & tags)
Format
- Purity
- >80%
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
- Purity Measurement Method
- SDS-PAGE (Coomassie Stain)
Storage & Handling
- Storage Conditions
- Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
