SMCO4 Protein (Over-Expression Lysate Myc-DDK (Flag))
Catalog Number: LS-G111285-100
100 µg (1 mg/mL) / $504.00
Expression System Human Embryonic Kidney 293
Format: Liquid
Purified recombinant protein SMCO4 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Human SMCO4 Protein (Recombinant Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$1130.00each
Catalog Number: LS-G70074-20
Catalog Number: LS-G70074
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Purified Recombinant protein of human chromosome 11 open reading frame 75 (C11orf75).
- Category
- Proteins & Peptides > Proteins > Recombinant Proteins
- Alternative Names
- C11orf75 | FN5 | Protein FN5 | UPF0443 protein C11orf75
- Origin Species
- Human
- NCBI GenBank
- NM_020179
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 6.6 kDa
- Protein Type
- Recombinant
- Amino Acid Sequence
1MRQLKGKPKK ETSKDKKERK QAMQEARQQI TTVVLPTLAV VVLLIVVFVY VATRPTITETRTRPLEQKLISEEDLAANDILDYKDDDDKV
59 aa + 31 aa (cloning site & tags)
Format
- Purity
- >80%
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
- Purity Measurement Method
- SDS-PAGE (Coomassie Stain)
Storage & Handling
- Storage Conditions
- Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
