PSENEN / PEN-2 Antibody
Catalog Number: LS-C833458
3 sizes / from $338.00
Antibody: Rabbit Polyclonal
Applications: Western Blot
Reactivity: Human, Mouse, Rat
Format: Liquid
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
Human PSENEN / PEN-2 Protein (Over-Expression Lysate Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293T |
| Format: | Lyophilized |
$153.00each
Catalog Number: LS-G87480-20
Catalog Number: LS-G87480
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- This product includes lyophilized lysate of HEK293T cells that have been transiently-tranfected with Human PEN2(PSENEN) (NM_172341) and is intended for use as a Western blot positive control. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4). See related products for a larger volume of this lysate supplied with a vector only control and 2x SDS-Page load buffer, or the purified form of this recombinant protein.
- Category
- Proteins & Peptides > Proteins > Lysates
- Alternative Names
- Gamma-secretase subunit PEN-2 | MSTP064 | PSENEN | Presenilin enhancer protein 2 | MDS033 | PEN-2 | PEN2
- Origin Species
- Human
- NCBI GenBank
- NM_172341
- SwissProt
- Q9NZ42
Protein
- Expression System
- Human Embryonic Kidney 293T
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 11.8 kDa
- Protein Type
- Lysate
- Amino Acid Sequence
1MNLERVSNEE KLNLCRKYYL GGFAFLPFLW LVNIFWFFRE AFLVPAYTEQ SQIKGYVWRS61AVGFLFWVIV LTSWITIFQI YRPRWGALGD YLSFTIPLGT PTRTRPLEQKLISEEDLAANDILDYKDDDDKV
101 aa + 31 aa (cloning site & tags)
Format
- Purity
- Unpurified
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Lyophilized
- Formulation
- Lyophilized. 25mM Tris-HCl, pH 7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProtein inhibitor cocktail mix, 1mM PMSF and 1mM NA3VO4
Storage & Handling
- Storage Conditions
- Store at -20°C for up to 1 year. Avoid freeze-thaw cycles.
