Human MT1HL1 Protein (Over-Expression Lysate Myc-DDK (Flag))
Catalog Number: LS-G96725-20
20 µg / $153.00
Expression System Human Embryonic Kidney 293T
Format: Lyophilized
Purified recombinant protein MT1P2 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Human MT1HL1 Protein (Recombinant Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$1130.00each
Catalog Number: LS-G73962-20
Catalog Number: LS-G73962
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Purified Recombinant protein of human metallothionein 1 pseudogene 2 (MT1P2).
- Category
- Proteins & Peptides > Proteins > Recombinant Proteins
- Origin Species
- Human
- NCBI GenBank
- NM_001039954
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 6.5 kDa
- Protein Type
- Recombinant
- Amino Acid Sequence
1MDPNCSCAAG GSYACAGSCK CKKCKCTSCK KSCCSCCPLG CAKCAQGCIR KGASEKCSCC61ATRTRPLEQKLISEEDLAANDILDYKDDDDKV
61 aa + 31 aa (cloning site & tags)
Format
- Purity
- >80%
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
- Purity Measurement Method
- SDS-PAGE (Coomassie Stain)
Storage & Handling
- Storage Conditions
- Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
