DEFB131 Antibody (N-Terminus)
Catalog Number: LS-C137177-100
100 µL (1 mg/mL) / $339.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general)
Reactivity: Human
Format: Liquid
Human DEFB131 Protein (Recombinant Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$1130.00each
Catalog Number: LS-G73107-20
Catalog Number: LS-G73107
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Purified Recombinant protein of human defensin, beta 131 (DEFB131).
- Category
- Proteins & Peptides > Proteins > Recombinant Proteins
- Alternative Names
- Beta-defensin 131 | Beta-defensin 31 | DEFB131 | Defensin | beta 31 | DEFB31 | beta 131 | DEFB-31
- Origin Species
- Human
- SwissProt
- P59861
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 8 kDa
- Protein Type
- Recombinant
- Amino Acid Sequence
1MRVLFFVFGV LSLMFTVPPG RSFISNDECP SEYYHCRLKC NADEHAIRYC ADFSICCKLK61IIEIDGQKKWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
70 aa + 31 aa (cloning site & tags)
Format
- Purity
- >80%
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
- Purity Measurement Method
- SDS-PAGE (Coomassie Stain)
Storage & Handling
- Storage Conditions
- Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
