C4orf3 Antibody
Catalog Number: LS-C399528
2 sizes / from $300.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay
Reactivity: Human
Format: Liquid
Purified recombinant protein C4orf3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Human C4orf3 Protein (Recombinant Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$1130.00each
Catalog Number: LS-G73866-20
Catalog Number: LS-G73866
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Purified recombinant protein of Homo sapiens chromosome 4 open reading frame 3 (C4orf3).
- Category
- Proteins & Peptides > Proteins > Recombinant Proteins
- Origin Species
- Human
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 7.4 kDa
- Protein Type
- Recombinant
- Amino Acid Sequence
1MEVDAPGVDG RDGLREQRGF SEGGRQNFDV RPQSGANGLP KHSYWLDLWL FILFDVVVFL61FVYFLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
66 aa + 31 aa (cloning site & tags)
Format
- Purity
- >80%
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
- Purity Measurement Method
- SDS-PAGE (Coomassie Stain)
Storage & Handling
- Storage Conditions
- Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
