ATP6V1G3 Antibody
Catalog Number: LS-C659934-100
100 µg / $338.00
Antibody: Rabbit Polyclonal
Applications: Enzyme-Linked Immunosorbent Assay, Immunohistochemistry (general), Western Blot
Reactivity: Human
Format: Liquid
Purified recombinant protein ATP6V1G3 was analyzed by SDS-PAGE gel and Coomassie Blue Staining
Human ATP6V1G3 Protein (Recombinant Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$1130.00each
Catalog Number: LS-G69663-20
Catalog Number: LS-G69663
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- Purified Recombinant protein of human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (ATP6V1G3), transcript variant 2.
- Category
- Proteins & Peptides > Proteins > Recombinant Proteins
- Alternative Names
- ATP6G3 | ATP6V1G3 | V-ATPase G subunit 3 | Vma10 | V-ATPase 13 kDa subunit 3 | V-ATPase G3 subunit | V-ATPase subunit G 3
- Origin Species
- Human
- NCBI GenBank
- NM_133262
- SwissProt
- Q96LB4
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 6.7 kDa
- Protein Type
- Recombinant
- Amino Acid Sequence
1MTSQSQGIHQ LLQAEKRAKD KLEEAKKILH LLFLKRRDWD CFWKRKAIEA SQGGSNGRNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
59 aa + 31 aa (cloning site & tags)
Format
- Purity
- >80%
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- Supplied in 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
- Purity Measurement Method
- SDS-PAGE (Coomassie Stain)
Storage & Handling
- Storage Conditions
- Store at -80°C for up to 12 months. Avoid freeze/thaw cycles.
