
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
HOPX / HOP Protein (Over-Expression Lysate Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$504.00each
Catalog Number: LS-G107068-100
Catalog Number: LS-G107068
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- This product includes lysate of HEK293T cells that have been transiently-tranfected with Human HOPX (NM_139212), cells transfected with the vector alone, and a reducing buffer for SDS-Page gel loading. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4).
- Category
- Proteins & Peptides > Proteins > Lysates
- Alternative Names
- CAMEO | HOD | HOPX | Homeodomain-only protein | HOP | HOP homeobox | LAGY | NECC1 | Odd homeobox protein 1 | OB1 | TOTO | Odd homeobox 1 protein | SMAP31
- Origin Species
- Human
- NCBI GenBank
- NM_032495
- SwissProt
- Q9BPY8
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 8.1 kda
- Protein Type
- Lysate
- Amino Acid Sequence
1MSAETASGPT EDQVEILEYN FNKVDKHPDS TTLCLIAAEA GLSEEETQKW FKQRLAKWRR61SEGLPSECRS VTDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
73 aa + 31 aa (cloning site & tags)
Format
- Purity
- Unpurified
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- 25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4.
- Concentration
- 1 mg/mL
Storage & Handling
- Storage Conditions
- Store at -80°C. Avoid freeze-thaw cycles. After incubation with SDS-PAGE sample buffer, SDS-PAGE samples need to be stored in -20°C for long term storage.
