Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
GYPB / CD235b / Glycophorin B Protein (Over-Expression Lysate Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$504.00each
Catalog Number: LS-G118190-100
Catalog Number: LS-G118190
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- This product includes lysate of HEK293T cells that have been transiently-tranfected with Human GYPB(GYPB) (NM_002100), cells transfected with the vector alone, and a reducing buffer for SDS-Page gel loading. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4).
- Category
- Proteins & Peptides > Proteins > Lysates
- Alternative Names
- Glycophorin-B | GPB | GPB.NY | GYPHe.NY | Glycophorin B (Ss blood group) | Glycophorin b precursor | Glycophorin MiIII | HGpMiX | Glycophorin HeP2 | Glycophorin MiVI | GpMiIII | GYPB | HGpMiIII | Sialoglycoprotein delta | SS | PAS-3 | SS-active sialoglycoprotein | CD235b | CD235b antigen | Glycophorin MiX | HGpMiVI | MNS | Ss blood group
- Origin Species
- Human
- NCBI GenBank
- NM_002100
- SwissProt
- P06028
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 9.78 kDa
- Protein Type
- Lysate
- Amino Acid Sequence
1MYGKIIFVLL LSEIVSISAL STTEVAMHTS TSSSVTKSYI SSQTNGETGQ LVHRFTVPAP61VVIILIILCV MAGIIGTILL ISYSIRRLIK ATRTRPLEQKLISEEDLAANDILDYKDDDDKV
91 aa + 31 aa (cloning site & tags)
Format
- Purity
- Unpurified
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- 25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4.
- Concentration
- 1 mg/mL
Storage & Handling
- Storage Conditions
- Store at -80°C. Avoid freeze-thaw cycles. After incubation with SDS-PAGE sample buffer, SDS-PAGE samples need to be stored in -20°C for long term storage.