
Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
DEFB1 / BD-1 Protein (Over-Expression Lysate Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$504.00each
Catalog Number: LS-G100480-100
Catalog Number: LS-G100480
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- This product includes lysate of HEK293T cells that have been transiently-tranfected with Human beta Defensin 1(DEFB1) (NM_005218), cells transfected with the vector alone, and a reducing buffer for SDS-Page gel loading. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4).
- Category
- Proteins & Peptides > Proteins > Lysates
- Alternative Names
- BD1 | Beta-defensin 1 | BD-1 | Beta Defensin 1 | DEFB-1 | DEFB101 | Defensin | beta 1 | Defensin beta | DEFB1 | HBD-1 | Beta-defensin-1 | HBD1
- Origin Species
- Human
- NCBI GenBank
- NM_005218
- SwissProt
- P60022
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 7.42 kDa
- Protein Type
- Lysate
- Amino Acid Sequence
1MRTSYLLLFT LCLLLSEMAS GGNFLTGLGH RSDHYNCVSS GGQCLYSACP IFTKIQGTCY61RGKAKCCKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
68 aa + 31 aa (cloning site & tags)
Format
- Purity
- Unpurified
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- 25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4.
- Concentration
- 1 mg/mL
Storage & Handling
- Storage Conditions
- Store at -80°C. Avoid freeze-thaw cycles. After incubation with SDS-PAGE sample buffer, SDS-PAGE samples need to be stored in -20°C for long term storage.
