Western validation with an anti-DDK antibody * L: Control HEK293 lysate R: Over-expression lysate
CDKN2B / p15 INK4b Protein (Over-Expression Lysate Myc-DDK (Flag))
ProteinLSBio Guarantee
| Expression System | Human Embryonic Kidney 293 |
| Format: | Liquid |
$504.00each
Catalog Number: LS-G107898-100
Catalog Number: LS-G107898
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- This product includes lysate of HEK293T cells that have been transiently-tranfected with Human p15 INK4b(CDKN2B) (NM_078487), cells transfected with the vector alone, and a reducing buffer for SDS-Page gel loading. Cells were lysed using Modified RIPA buffer (25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4).
- Category
- Proteins & Peptides > Proteins > Lysates
- Alternative Names
- CDK inhibitory protein | CDK4B inhibitor | CDKN2B | INK4B | MTS2 | Multiple tumor suppressor 2 | p14_INK4B | p15 | p14_CDK inhibitor | p15 CDK inhibitor | p15 INK4b | p15-INK4b | p15_INK4B | p14-INK4b | p15INK4b | CDK4I | MTS-2 | TP15
- Origin Species
- Human
- NCBI GenBank
- NM_004936
- SwissProt
- P42772
Protein
- Expression System
- Human Embryonic Kidney 293
- Fusion Tag
- c-Myc Epitope Tag (EQKLISEEDL), FLAG Octapeptide Tag (DYKDDDDK)
- Molecular Weight
- 7.9 kDa
- Protein Type
- Lysate
- Amino Acid Sequence
1MREENKGMPS GGGSDEGLAS AAARGLVEKV RQLLEAGADP NGVNRFGRRA IQVAGAPGPR61RQGARERGAR PRRIGAGTSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
78 aa + 34 aa (cloning site & tags)
Format
- Purity
- Unpurified
- Conjugate/Label
- Unconjugated
- Endotoxin Level
- Not Tested
- Format
- Liquid
- Formulation
- 25mM Tris-HCl pH7.6, 150mM NaCl, 1% NP-40, 1mM EDTA, 1xProteinase inhibitor cocktail mix, 1mM PMSF and 1mM Na3VO4.
- Concentration
- 1 mg/mL
Storage & Handling
- Storage Conditions
- Store at -80°C. Avoid freeze-thaw cycles. After incubation with SDS-PAGE sample buffer, SDS-PAGE samples need to be stored in -20°C for long term storage.