Human Apolipoprotein H Antibody (IgG) ELISA Kit (Sandwich ELISA)
Catalog Number: LS-F67372-1
1 plate / $591.00
Reactivity: Human
Detection Method Colorimetric
Format: 96-Well Strip Plate
Western blot testing of human 1) HeLa, 2) placenta, 3) A549, 4) T-47D, 5) PC-3 and 6) U-2 OS cell lysate with ZP3 antibody at 0.5ug/ml. Predicted molecular weight ~47 kDa.
ZP3 Antibody
Primary AntibodyLSBio Guarantee
| Antibody: | Rabbit Polyclonal |
| Applications: | Western Blot |
| Reactivity: | Human |
| Format: | Lyophilized |
$587.00each
Catalog Number: LS-C782868-100
Catalog Number: LS-C782868
For bulk orders or custom formulations:
Request a QuoteOverview
- Description
- ZP3 antibody LS-C782868 is an unconjugated rabbit polyclonal antibody to human ZP3. Validated for WB.
- Application
- WB
- Reactivity
- Hu
- Intended Use
- Research Use Only
- Guarantees
- This antibody carries the LSBio 100% Guarantee. ✓
- Category
- Antibodies > Primary Antibodies > Polyclonal Antibodies
- Alternative Names
- Zona pellucida glycoprotein 3B | Zp-3 | ZP3 | ZP3-424 | ZP3A | ZP3B | ZP3-372 | ZPC | Sperm receptor | Zona pellucida glycoprotein 3 | Zona pellucida protein C
- Recommended Dilution: WB
- 0.5 - 1 µg/ml
- UniProt Number
- P21754
- SwissProt
- P21754
Target
- Target
- Human ZP3
- Antigen Species
- Human
- Gene Name
- ZP3
Antibody
- Host Species
- Rabbit
- Clonality
- Polyclonal
- Isotype
- IgG
- Origin Species
- Human
Immunogen
- Immunogen
- Amino acids LRLMEENWNAEKRSPTFHLGDAAHLQAEIHT from the human protein were used as the immunogen for the ZP3 antibody.
Format
- Conjugate/Label
- Unconjugated
- Format
- Lyophilized
- Formulation
- Lyophilized from PBS, 2% Trehalose, 0.025% sodium azide
- Preservative
- Yes
- Purification Method
- Affinity Purified
Storage & Handling
- Storage Conditions
- After reconstitution, store at 4°C for up to 1 month. Long-term: aliquot and store at -20°C. Avoid freeze-thaws cycles.
- Recommended Storage Buffer
- PBS
