Western blot analysis of extracts of U-87MG cells, using ZNF157 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 1s.

ZNF157 Antibody

Primary AntibodyLSBio Guarantee

Antibody:	Rabbit Polyclonal
Applications:	Western Blot
Reactivity:	Human
Format:	Liquid

$281.00each

Catalog Number: LS-C749329-20

Unit Size

Quantity

For bulk orders or custom formulations:

Overview

Description: ZNF157 antibody LS-C749329 is an unconjugated rabbit polyclonal antibody to human ZNF157. Validated for WB.
Application: WB
Reactivity: Hu
Intended Use: Research Use Only
Guarantees: This antibody carries the LSBio 100% Guarantee. ✓
Category: Antibodies > Primary Antibodies > Polyclonal Antibodies
Alternative Names: HZF22 | Zinc finger protein 22 | Zinc finger protein 157 | Zinc finger protein HZF22 | ZNF157
Recommended Dilution: WB: 1:500 - 1:2000
NCBI GenBank: NM_003446 | NP_003437.2

Target

Target: Human ZNF157
Antigen Species: Human

Antibody

Host Species: Rabbit
Clonality: Polyclonal
Isotype: IgG

Immunogen

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 70-165 of human ZNF157 (NP_003437.2). VAKPEMIFKLERGEELWILEEESSGHGYSGSLSLLCGNGSVGDNALRHDNDLLHHQKIQTLDQNVEYNGCRKAFHEKTGFVRRKRTPRGDKNFECH
Immunogen Type: Fusion Protein (e.g., GST, MBP tag)